Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331613.1	5prime_partial	203	1-612(+)
Amino Acid sequence :
VKSYYYIFFSSKMEYSGCLKTELTLALPGGAGAAEPPPKSGAKRGFSDIMDLKLGVSTCDDDGASVSTPPPPKAQVVGWPPVRKRMMKSCKYVKVAVDGAPFLRKVDLEIYTAYPHLLAA LKDMLHACFTICSVVKEKKMMEGSNGTEYVATYEDRDGDWMLVGDVPWKMFVESCKRMRLMKSSEAIELAPKASSKGLSKRSL*
Physicochemical properties
Number of amino acids:		203
Molecular weight:		22,339.919
Theoretical pI:		9.021
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		29910 30285
Instability index:		47.155
aromaticity		0.089
GRAVY		-0.205
Secondary Structure Fraction
Helix		0.276
turn		0.241
sheet		0.276