| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331614.1 | internal | 237 | 3-713(+) |
Amino Acid sequence : | |||
| RQPMVSVEIGHGSVLIRHPNSVVREEESEASSLSVDKQYTLNSRLKSFHGFTDDTGAYSSSKANEKIKKSVYPEALQEQTRRDKDHVVKLPILAHHNSPLCYVDLQDIVNFDIFSSHLTN DEQQQLMKLLPSVDTFDAPYSLNSMFGSIEFNQNLSSFQNLIAEGVFDNSFGGVRTEDCRILKRLVLSDLAKSKWVEQHTSFKDSKCKSSTKLVGGYDDFEIVTGANLKRSRDGLHQ | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 13,840.904 | ||
| Theoretical pI: | 9.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
| Instability index: | 36.594 | ||
| aromaticity | 0.132 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.298 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331614.1 | 5prime_partial | 121 | 715-350(-) |
Amino Acid sequence : | |||
| FWCSPSRDRFKFAPVTISKSSYPPTNLVLLLHFESLKDVCCSTHFDFAKSLNTSRFKILQSSVLTPPNELSKTPSAIRFWKEDRFWLNSMLPNMLLRLYGASKVSTEGNSFINCCCSSFV K* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,840.904 | ||
| Theoretical pI: | 9.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
| Instability index: | 36.594 | ||
| aromaticity | 0.132 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.298 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331614.1 | internal | 237 | 3-713(+) |
Amino Acid sequence : | |||
| RQPMVSVEIGHGSVLIRHPNSVVREEESEASSLSVDKQYTLNSRLKSFHGFTDDTGAYSSSKANEKIKKSVYPEALQEQTRRDKDHVVKLPILAHHNSPLCYVDLQDIVNFDIFSSHLTN DEQQQLMKLLPSVDTFDAPYSLNSMFGSIEFNQNLSSFQNLIAEGVFDNSFGGVRTEDCRILKRLVLSDLAKSKWVEQHTSFKDSKCKSSTKLVGGYDDFEIVTGANLKRSRDGLHQ | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 13,840.904 | ||
| Theoretical pI: | 9.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
| Instability index: | 36.594 | ||
| aromaticity | 0.132 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.298 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331614.1 | 5prime_partial | 121 | 715-350(-) |
Amino Acid sequence : | |||
| FWCSPSRDRFKFAPVTISKSSYPPTNLVLLLHFESLKDVCCSTHFDFAKSLNTSRFKILQSSVLTPPNELSKTPSAIRFWKEDRFWLNSMLPNMLLRLYGASKVSTEGNSFINCCCSSFV K* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,840.904 | ||
| Theoretical pI: | 9.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
| Instability index: | 36.594 | ||
| aromaticity | 0.132 | ||
| GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.298 | ||
| sheet | 0.198 | ||