Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331627.1 | complete | 156 | 21-491(+) |
Amino Acid sequence : | |||
MSVITDEMRTAASEIYHGDEICQEKSKFLLTEVGLPNGLLPLKDIVECGYIKETGFVWLIQKEKTEHKFEKIGKLVQYATEVTAYVEPGRIRKLTGVKAKELLLWVGLTDINMDPTTAKI TFKSIAGLSRTFPVDAFVVEEKVKTTAASGDLVKEV* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 12,085.431 | ||
Theoretical pI: | 4.826 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 39.968 | ||
aromaticity | 0.054 | ||
GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.321 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331627.1 | complete | 112 | 662-324(-) |
Amino Acid sequence : | |||
MLNPSYGAFLLKLQIVGSMDNPPLNVGIEGVSSWIRTLDTRPSEKGFKNLEIWHDHSLNLLNKVTGGGGGLDLLLHDECVDRECAGQARDGFEGDLCGGGVHVNISETNPQQ* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,085.431 | ||
Theoretical pI: | 4.826 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 39.968 | ||
aromaticity | 0.054 | ||
GRAVY | -0.293 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.321 | ||
sheet | 0.241 |