| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331635.1 | internal | 276 | 2-829(+) |
Amino Acid sequence : | |||
| FQSMESTHRNCLTNSSDVKELIPEFFYMPEFLVNSNSYHFGVKQDGEPIGDVSLPPWAKGSADEFINKNREALESEYVSSNLHHWIDLVFGYKQRGKPAVEAANIFYYLTYEGAVDLDNM EDDLQRSAIEDQIANFGQTPIQLFKKKHPRRGAPIPIAHPLRYALASINLTSIVPCPSNSPSAAVYVSVLDSYIICVSQSLTVSVKTWMTTHLQSGGNFTFSGSQDPFFGIGSDILSPFQ IGSPLADNFELGAQCFATMQTSTENFLISSXHWENS | |||
Physicochemical properties | |||
| Number of amino acids: | 276 | ||
| Molecular weight: | 30,596.890 | ||
| Theoretical pI: | 4.929 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37150 | ||
| Instability index: | 48.168 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.295 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331635.1 | internal | 276 | 2-829(+) |
Amino Acid sequence : | |||
| FQSMESTHRNCLTNSSDVKELIPEFFYMPEFLVNSNSYHFGVKQDGEPIGDVSLPPWAKGSADEFINKNREALESEYVSSNLHHWIDLVFGYKQRGKPAVEAANIFYYLTYEGAVDLDNM EDDLQRSAIEDQIANFGQTPIQLFKKKHPRRGAPIPIAHPLRYALASINLTSIVPCPSNSPSAAVYVSVLDSYIICVSQSLTVSVKTWMTTHLQSGGNFTFSGSQDPFFGIGSDILSPFQ IGSPLADNFELGAQCFATMQTSTENFLISSXHWENS | |||
Physicochemical properties | |||
| Number of amino acids: | 276 | ||
| Molecular weight: | 30,596.890 | ||
| Theoretical pI: | 4.929 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 37150 | ||
| Instability index: | 48.168 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.295 | ||
| sheet | 0.218 | ||