Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331641.1 | internal | 279 | 1-837(+) |
Amino Acid sequence : | |||
KRFVNSEGIIDKQGLEFKAIVSNGLKLGASLAMAEHIPSLRWMFPLDEDAFAKHGARRDQLTREIMEEHTRAREESGGAKQHFFDALLTLKDKYDLSEDTIIGLLWDMITAGMDTTAISV EWAMAELIKNPRVQQKAQEELDRVIGYERVMTELDFSNLPYLQCVAKEALRLHPPTPLMLPHRSNSNVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPSEFRPERFLEEDVDMKGHDFRL LPFGAGRRVCPGAQLGINLVTSMIGHLLHHFNWAPPSXV | |||
Physicochemical properties | |||
Number of amino acids: | 279 | ||
Molecular weight: | 13,105.155 | ||
Theoretical pI: | 10.231 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 74.420 | ||
aromaticity | 0.033 | ||
GRAVY | 0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.350 | ||
sheet | 0.244 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331641.1 | 3prime_partial | 123 | 371-3(-) |
Amino Acid sequence : | |||
MAHSTDIAVVSIPAVIMSQRRPMMVSSLRSYLSLSVSKASKKCCLAPPLSSRARVCSSIISRVSWSRRAPCLAKASSSSGNIQRSDGICSAIAREAPSFSPLETMALNSSPCLSIIPSEF TNR | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,105.155 | ||
Theoretical pI: | 10.231 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 74.420 | ||
aromaticity | 0.033 | ||
GRAVY | 0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.350 | ||
sheet | 0.244 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331641.1 | internal | 279 | 1-837(+) |
Amino Acid sequence : | |||
KRFVNSEGIIDKQGLEFKAIVSNGLKLGASLAMAEHIPSLRWMFPLDEDAFAKHGARRDQLTREIMEEHTRAREESGGAKQHFFDALLTLKDKYDLSEDTIIGLLWDMITAGMDTTAISV EWAMAELIKNPRVQQKAQEELDRVIGYERVMTELDFSNLPYLQCVAKEALRLHPPTPLMLPHRSNSNVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPSEFRPERFLEEDVDMKGHDFRL LPFGAGRRVCPGAQLGINLVTSMIGHLLHHFNWAPPSXV | |||
Physicochemical properties | |||
Number of amino acids: | 279 | ||
Molecular weight: | 13,105.155 | ||
Theoretical pI: | 10.231 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 74.420 | ||
aromaticity | 0.033 | ||
GRAVY | 0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.350 | ||
sheet | 0.244 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331641.1 | 3prime_partial | 123 | 371-3(-) |
Amino Acid sequence : | |||
MAHSTDIAVVSIPAVIMSQRRPMMVSSLRSYLSLSVSKASKKCCLAPPLSSRARVCSSIISRVSWSRRAPCLAKASSSSGNIQRSDGICSAIAREAPSFSPLETMALNSSPCLSIIPSEF TNR | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,105.155 | ||
Theoretical pI: | 10.231 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
Instability index: | 74.420 | ||
aromaticity | 0.033 | ||
GRAVY | 0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.350 | ||
sheet | 0.244 |