Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331656.1 | 3prime_partial | 224 | 3-674(+) |
Amino Acid sequence : | |||
MADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG AGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYDNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKY | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 15,068.392 | ||
Theoretical pI: | 7.137 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 22.132 | ||
aromaticity | 0.028 | ||
GRAVY | 0.406 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.224 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331656.1 | 3prime_partial | 143 | 431-3(-) |
Amino Acid sequence : | |||
MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRH | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,068.392 | ||
Theoretical pI: | 7.137 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 22.132 | ||
aromaticity | 0.028 | ||
GRAVY | 0.406 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.224 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331656.1 | 3prime_partial | 224 | 3-674(+) |
Amino Acid sequence : | |||
MADTFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEEIG AGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYDNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPAKY | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 15,068.392 | ||
Theoretical pI: | 7.137 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 22.132 | ||
aromaticity | 0.028 | ||
GRAVY | 0.406 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.224 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331656.1 | 3prime_partial | 143 | 431-3(-) |
Amino Acid sequence : | |||
MTKRHVLRGFVSGVPKHVALVTGPDLLRAFGQMAVNALSDIRALLLDVDKNLALVSIETNVVGNKPYRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLAIGILLEASIENRVGD LIAELVGVPLVHALGGKQEGVRH | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,068.392 | ||
Theoretical pI: | 7.137 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 22.132 | ||
aromaticity | 0.028 | ||
GRAVY | 0.406 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.224 | ||
sheet | 0.308 |