| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331658.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
| LVEGPLNNLKQSMVQFQKPKKIYNERRLFYGGGAGAVPNDNFGSISSSSNTDRRGPRSRSPYMPPGPPNGAHKPGVHPSGYAMPRVPMPPYHGGPPSQPYAIPARSGVHGPVGAVPQIPQ PGSRGFGVGRGNSSAPIGSHLPHQQGGQPPIGSLASNFNFPPMDTASSQPNVAGPLSQPGYVSNVAGQGPNQTYRDGFSMGGMSQDVLNDDFKSQGSHIPYNVADFSTQASQSGYAVDYV TQGGQGGFPGS | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 16,708.876 | ||
| Theoretical pI: | 5.232 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 45.826 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.872 | ||
Secondary Structure Fraction | |||
| Helix | 0.459 | ||
| turn | 0.169 | ||
| sheet | 0.351 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331658.1 | complete | 148 | 73-519(+) |
Amino Acid sequence : | |||
| MNEDSSMVVEQVLFPMIILDLFPQAQILIGGVLALGVRTCLLAHPMVPINLVFILLVMQCLEYPCPHTMEDLHHNRMPYLLVVVYMDLLVLYLKFHNLVAEDSVLAVETLVHPSVVIFHT SKVDNLQSEALHLTSISHLWILLVASLM* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,708.876 | ||
| Theoretical pI: | 5.232 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 45.826 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.872 | ||
Secondary Structure Fraction | |||
| Helix | 0.459 | ||
| turn | 0.169 | ||
| sheet | 0.351 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331658.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
| LVEGPLNNLKQSMVQFQKPKKIYNERRLFYGGGAGAVPNDNFGSISSSSNTDRRGPRSRSPYMPPGPPNGAHKPGVHPSGYAMPRVPMPPYHGGPPSQPYAIPARSGVHGPVGAVPQIPQ PGSRGFGVGRGNSSAPIGSHLPHQQGGQPPIGSLASNFNFPPMDTASSQPNVAGPLSQPGYVSNVAGQGPNQTYRDGFSMGGMSQDVLNDDFKSQGSHIPYNVADFSTQASQSGYAVDYV TQGGQGGFPGS | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 16,708.876 | ||
| Theoretical pI: | 5.232 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 45.826 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.872 | ||
Secondary Structure Fraction | |||
| Helix | 0.459 | ||
| turn | 0.169 | ||
| sheet | 0.351 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331658.1 | complete | 148 | 73-519(+) |
Amino Acid sequence : | |||
| MNEDSSMVVEQVLFPMIILDLFPQAQILIGGVLALGVRTCLLAHPMVPINLVFILLVMQCLEYPCPHTMEDLHHNRMPYLLVVVYMDLLVLYLKFHNLVAEDSVLAVETLVHPSVVIFHT SKVDNLQSEALHLTSISHLWILLVASLM* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,708.876 | ||
| Theoretical pI: | 5.232 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 45.826 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.872 | ||
Secondary Structure Fraction | |||
| Helix | 0.459 | ||
| turn | 0.169 | ||
| sheet | 0.351 | ||