| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331660.1 | 5prime_partial | 144 | 2-436(+) |
Amino Acid sequence : | |||
| KNPPKKTLKNLCKNDAHDLLLGQKRDHPLRFMEDRFMAELLPLSLRRLPPLRLLPVHGGPPPPIAPPPPPRQVDAALRRRNPSSNPQAARPQLGPAPIFGGDSLRSQLGDRVFSDAGRDV VQRRRFHRDRGRPRRRVLDFPRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,188.912 | ||
| Theoretical pI: | 8.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 47.210 | ||
| aromaticity | 0.153 | ||
| GRAVY | 0.576 | ||
Secondary Structure Fraction | |||
| Helix | 0.424 | ||
| turn | 0.229 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331660.1 | complete | 144 | 42-476(+) |
Amino Acid sequence : | |||
| MMHMTFYWGRSVTILFDSWKTDSWPSYFLSLFAVFLLSVFYQYMEDRRLRLRLLHLPAKSTPPSAAETPLLIPKLRGRSWAPHQFLGAILFGVNSAIGYFLMLAVMSFNGGVFIAIVVGL AVGYLIFRGGDEDVVIVDNPCACA* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,188.912 | ||
| Theoretical pI: | 8.662 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
| Instability index: | 47.210 | ||
| aromaticity | 0.153 | ||
| GRAVY | 0.576 | ||
Secondary Structure Fraction | |||
| Helix | 0.424 | ||
| turn | 0.229 | ||
| sheet | 0.278 | ||