Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331660.1 | 5prime_partial | 144 | 2-436(+) |
Amino Acid sequence : | |||
KNPPKKTLKNLCKNDAHDLLLGQKRDHPLRFMEDRFMAELLPLSLRRLPPLRLLPVHGGPPPPIAPPPPPRQVDAALRRRNPSSNPQAARPQLGPAPIFGGDSLRSQLGDRVFSDAGRDV VQRRRFHRDRGRPRRRVLDFPRRR* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,188.912 | ||
Theoretical pI: | 8.662 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
Instability index: | 47.210 | ||
aromaticity | 0.153 | ||
GRAVY | 0.576 | ||
Secondary Structure Fraction | |||
Helix | 0.424 | ||
turn | 0.229 | ||
sheet | 0.278 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331660.1 | complete | 144 | 42-476(+) |
Amino Acid sequence : | |||
MMHMTFYWGRSVTILFDSWKTDSWPSYFLSLFAVFLLSVFYQYMEDRRLRLRLLHLPAKSTPPSAAETPLLIPKLRGRSWAPHQFLGAILFGVNSAIGYFLMLAVMSFNGGVFIAIVVGL AVGYLIFRGGDEDVVIVDNPCACA* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 16,188.912 | ||
Theoretical pI: | 8.662 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
Instability index: | 47.210 | ||
aromaticity | 0.153 | ||
GRAVY | 0.576 | ||
Secondary Structure Fraction | |||
Helix | 0.424 | ||
turn | 0.229 | ||
sheet | 0.278 |