Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331662.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
TLAWTLILYSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWGETGAEYIVESTGVFTD KDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPAL NGKLTGMAFRVPTVDV | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 15,639.397 | ||
Theoretical pI: | 6.439 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22625 | ||
Instability index: | 66.363 | ||
aromaticity | 0.049 | ||
GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.317 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331662.1 | 5prime_partial | 142 | 770-342(-) |
Amino Acid sequence : | |||
NINCWDTEGHSSQLSIQSRENFANSLCSSGATWDNIERCSSSAPPVLGRWSINSLLSCSNRVDCCHKTFDNTKPIIDNLSQWGKAVCGTTSIGHNIQVRCVCLFINTDDKHGCILTRSRN DDLLCTTLQMSRSLILVGENSS* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,639.397 | ||
Theoretical pI: | 6.439 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22625 | ||
Instability index: | 66.363 | ||
aromaticity | 0.049 | ||
GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.317 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331662.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
TLAWTLILYSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWGETGAEYIVESTGVFTD KDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVGKVLPAL NGKLTGMAFRVPTVDV | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 15,639.397 | ||
Theoretical pI: | 6.439 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22625 | ||
Instability index: | 66.363 | ||
aromaticity | 0.049 | ||
GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.317 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331662.1 | 5prime_partial | 142 | 770-342(-) |
Amino Acid sequence : | |||
NINCWDTEGHSSQLSIQSRENFANSLCSSGATWDNIERCSSSAPPVLGRWSINSLLSCSNRVDCCHKTFDNTKPIIDNLSQWGKAVCGTTSIGHNIQVRCVCLFINTDDKHGCILTRSRN DDLLCTTLQMSRSLILVGENSS* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,639.397 | ||
Theoretical pI: | 6.439 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22625 | ||
Instability index: | 66.363 | ||
aromaticity | 0.049 | ||
GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.317 | ||
sheet | 0.155 |