| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331681.1 | 5prime_partial | 263 | 1-792(+) |
Amino Acid sequence : | |||
| KIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPI RVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQV SYAIGVAEPLSVFVDTYKTGTIP* | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 28,242.864 | ||
| Theoretical pI: | 7.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 23.310 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.232 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331681.1 | 5prime_partial | 263 | 1-792(+) |
Amino Acid sequence : | |||
| KIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPI RVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQV SYAIGVAEPLSVFVDTYKTGTIP* | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 28,242.864 | ||
| Theoretical pI: | 7.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 23.310 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.232 | ||
| sheet | 0.183 | ||