| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331686.1 | internal | 189 | 1-567(+) |
Amino Acid sequence : | |||
| DFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTINGAKESTVNAYKKQFQSDLGVFLRSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIP IYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPNDAGEISRAYVSLCRSLTGGLVDAHIGDQLG | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 20,989.374 | ||
| Theoretical pI: | 5.091 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 41.921 | ||
| aromaticity | 0.106 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.259 | ||
| sheet | 0.249 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331686.1 | internal | 189 | 1-567(+) |
Amino Acid sequence : | |||
| DFFYSAFSLHWLSQIPKEVMEKGSAAYNEGRVTINGAKESTVNAYKKQFQSDLGVFLRSRSKELKPGGSMFLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIP IYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPNDAGEISRAYVSLCRSLTGGLVDAHIGDQLG | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 20,989.374 | ||
| Theoretical pI: | 5.091 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 41.921 | ||
| aromaticity | 0.106 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.259 | ||
| sheet | 0.249 | ||