| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331699.1 | internal | 204 | 1-612(+) |
Amino Acid sequence : | |||
| SSHLRSLSSSNPVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQG VHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVSIRVHT | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 22,265.881 | ||
| Theoretical pI: | 5.107 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 43.104 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.225 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331699.1 | internal | 204 | 1-612(+) |
Amino Acid sequence : | |||
| SSHLRSLSSSNPVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQG VHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVSIRVHT | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 22,265.881 | ||
| Theoretical pI: | 5.107 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 43.104 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.413 | ||
Secondary Structure Fraction | |||
| Helix | 0.245 | ||
| turn | 0.225 | ||
| sheet | 0.225 | ||