| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331702.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| KSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAI KEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAI KDEVEDLEXAGITVIKIDEAA | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 28,966.770 | ||
| Theoretical pI: | 8.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 40.452 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.200 | ||
| sheet | 0.288 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331702.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| KSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAI KEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAI KDEVEDLEXAGITVIKIDEAA | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 28,966.770 | ||
| Theoretical pI: | 8.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 40.452 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.339 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.200 | ||
| sheet | 0.288 | ||