| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331712.1 | 5prime_partial | 222 | 760-92(-) |
Amino Acid sequence : | |||
| PGLIAEVKKASPSRGVLREDFDPVAIAKAYEKGGAACLSVLTDEKFFQGSFENLEIIRNSGVQCPLLCKEFIVDVWQIYYARVKGADAVLLIAAVLSDFEIKYMIKICKLLGLAALVEVH DEREMDRVLAIEGIELVGINNRDLGTFKVDISNTKKLLEGERGERIRKKDIIVVGESGLFTPDDIAYVQGAGVKAVLVGESIVKKKDPTAGIVELFGKDIAS* | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 18,572.139 | ||
| Theoretical pI: | 10.923 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 78.187 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.358 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331712.1 | 5prime_partial | 173 | 3-524(+) |
Amino Acid sequence : | |||
| PFGMVNAFKTYVRNRFNFHNMALSANTNTSQEAISLPNSSTIPAVGSFFFTIDSPTSTAFTPAPCTYAMSSGVNSPDSPTTMMSFLRILSPRSPSRSFFVLLISTLNVPRSRLLMPTSSM PSIAKTRSISLSSCTSTSAASPSNLHILIMYLISKSDKTAAINRTASAPLTRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 18,572.139 | ||
| Theoretical pI: | 10.923 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 78.187 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.358 | ||
| sheet | 0.225 | ||