| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331717.1 | internal | 283 | 3-851(+) |
Amino Acid sequence : | |||
| EVQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLY LKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSD DKCIEILKKXQEAIPASTGKVMIVDAIINEDGEGDEFSGARLS | |||
Physicochemical properties | |||
| Number of amino acids: | 283 | ||
| Molecular weight: | 12,643.123 | ||
| Theoretical pI: | 11.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 72.538 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.418 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331717.1 | 5prime_partial | 131 | 851-456(-) |
Amino Acid sequence : | |||
| RQTSTRKLVAFSIFVNYSIYNHHFSSTRWNRFLXFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKR RRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 12,643.123 | ||
| Theoretical pI: | 11.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 72.538 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.418 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331717.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
| RSSTSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPL SQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 12,643.123 | ||
| Theoretical pI: | 11.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 72.538 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.418 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331717.1 | complete | 125 | 416-39(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 12,643.123 | ||
| Theoretical pI: | 11.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 72.538 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.418 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331717.1 | 5prime_partial | 123 | 853-482(-) |
Amino Acid sequence : | |||
| NDKRAPENSSPSPSSLIIASTIITFPVLAGIASXHFFRISMHLSSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTDRNPSN AAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 12,643.123 | ||
| Theoretical pI: | 11.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 72.538 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.418 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331717.1 | internal | 283 | 3-851(+) |
Amino Acid sequence : | |||
| EVQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLY LKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSD DKCIEILKKXQEAIPASTGKVMIVDAIINEDGEGDEFSGARLS | |||
Physicochemical properties | |||
| Number of amino acids: | 283 | ||
| Molecular weight: | 12,643.123 | ||
| Theoretical pI: | 11.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 72.538 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.418 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331717.1 | 5prime_partial | 131 | 851-456(-) |
Amino Acid sequence : | |||
| RQTSTRKLVAFSIFVNYSIYNHHFSSTRWNRFLXFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKR RRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 12,643.123 | ||
| Theoretical pI: | 11.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 72.538 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.418 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331717.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
| RSSTSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPL SQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 12,643.123 | ||
| Theoretical pI: | 11.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 72.538 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.418 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331717.1 | complete | 125 | 416-39(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 12,643.123 | ||
| Theoretical pI: | 11.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 72.538 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.418 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331717.1 | 5prime_partial | 123 | 853-482(-) |
Amino Acid sequence : | |||
| NDKRAPENSSPSPSSLIIASTIITFPVLAGIASXHFFRISMHLSSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTDRNPSN AAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 12,643.123 | ||
| Theoretical pI: | 11.617 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 72.538 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.170 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.418 | ||
| sheet | 0.205 | ||