| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331720.1 | internal | 147 | 3-443(+) |
Amino Acid sequence : | |||
| SRQMKSVFVLHLLSAKRVQSFRSIREEETALFVKRVEESIGPVNLSDMFGEFTNDVICRSAFGEKFRESEKGKKLVWLLREIIALLGMISLGDFIPWLGWIDRVNGLDKRLDRVAREMDD FLNDVIDERVEVTKGGNLSENFVDIML | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,075.213 | ||
| Theoretical pI: | 11.340 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 50.879 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.346 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331720.1 | 5prime_partial | 136 | 442-32(-) |
Amino Acid sequence : | |||
| SIISTKFSDRFPPFVTSTRSSITSFKKSSISLATLSSLLSKPLTRSIQPSHGIKSPKLIIPKRAIISLNNHTSFFPFSDSLNFSPKADLQITSFVNSPNMSLRFTGPIDSSTLFTKRAVS SSLMERKDWTLFALSR* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,075.213 | ||
| Theoretical pI: | 11.340 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 50.879 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.346 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331720.1 | internal | 147 | 3-443(+) |
Amino Acid sequence : | |||
| SRQMKSVFVLHLLSAKRVQSFRSIREEETALFVKRVEESIGPVNLSDMFGEFTNDVICRSAFGEKFRESEKGKKLVWLLREIIALLGMISLGDFIPWLGWIDRVNGLDKRLDRVAREMDD FLNDVIDERVEVTKGGNLSENFVDIML | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,075.213 | ||
| Theoretical pI: | 11.340 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 50.879 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.346 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331720.1 | 5prime_partial | 136 | 442-32(-) |
Amino Acid sequence : | |||
| SIISTKFSDRFPPFVTSTRSSITSFKKSSISLATLSSLLSKPLTRSIQPSHGIKSPKLIIPKRAIISLNNHTSFFPFSDSLNFSPKADLQITSFVNSPNMSLRFTGPIDSSTLFTKRAVS SSLMERKDWTLFALSR* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,075.213 | ||
| Theoretical pI: | 11.340 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 50.879 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.309 | ||
| turn | 0.346 | ||
| sheet | 0.162 | ||