Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331722.1 | internal | 277 | 1-831(+) |
Amino Acid sequence : | |||
RLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATL LIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVG VVFGYGDVGQGCAAALKQAGARVIVTEIDPICALQVL | |||
Physicochemical properties | |||
Number of amino acids: | 277 | ||
Molecular weight: | 21,634.800 | ||
Theoretical pI: | 11.803 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 99.311 | ||
aromaticity | 0.027 | ||
GRAVY | -1.653 | ||
Secondary Structure Fraction | |||
Helix | 0.168 | ||
turn | 0.266 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331722.1 | 5prime_partial | 228 | 831-145(-) |
Amino Acid sequence : | |||
EDLQGADGVDLGHDHAGPGLLQGSCAPLTDISVAEDNAHLSGDHHVGRPHQAVGERVPASVQVVELALSDRVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILRWILLQSI SDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRCIAAVVDDQIRSAAGAPIERALGAPPVFLESLPLPGEDGGAVASDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 21,634.800 | ||
Theoretical pI: | 11.803 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 99.311 | ||
aromaticity | 0.027 | ||
GRAVY | -1.653 | ||
Secondary Structure Fraction | |||
Helix | 0.168 | ||
turn | 0.266 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331722.1 | 5prime_partial | 184 | 3-557(+) |
Amino Acid sequence : | |||
PRNRPRRGRDARPHVVPHRIRPLPAIQGRQDHRQPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRSRQRRRLRLEGGDSPGILVVHRARARLGPRRRTGSDRRRRRRCNAV DSRGGEGGGGVREEREAAGSELHRQRRISDRVDDYQRWIEGESNEVYEDEGEIGGRFGGDDDWR* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 21,634.800 | ||
Theoretical pI: | 11.803 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 99.311 | ||
aromaticity | 0.027 | ||
GRAVY | -1.653 | ||
Secondary Structure Fraction | |||
Helix | 0.168 | ||
turn | 0.266 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331722.1 | internal | 277 | 1-831(+) |
Amino Acid sequence : | |||
RLEIDLAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATL LIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKENPTKYTKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVG VVFGYGDVGQGCAAALKQAGARVIVTEIDPICALQVL | |||
Physicochemical properties | |||
Number of amino acids: | 277 | ||
Molecular weight: | 21,634.800 | ||
Theoretical pI: | 11.803 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 99.311 | ||
aromaticity | 0.027 | ||
GRAVY | -1.653 | ||
Secondary Structure Fraction | |||
Helix | 0.168 | ||
turn | 0.266 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331722.1 | 5prime_partial | 228 | 831-145(-) |
Amino Acid sequence : | |||
EDLQGADGVDLGHDHAGPGLLQGSCAPLTDISVAEDNAHLSGDHHVGRPHQAVGERVPASVQVVELALSDRVVNVNGGEKQSAISLHLIQPLNASRRLLRNAHQSLLHLRILRWILLQSI SDNRQHDLKFGVVGGARIRQLPALRVLLLRLHPLVNQQRCIAAVVDDQIRSAAGAPIERALGAPPVFLESLPLPGEDGGAVASDDGGGVVLRGEDVAGAPADLGAERG* | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 21,634.800 | ||
Theoretical pI: | 11.803 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 99.311 | ||
aromaticity | 0.027 | ||
GRAVY | -1.653 | ||
Secondary Structure Fraction | |||
Helix | 0.168 | ||
turn | 0.266 | ||
sheet | 0.174 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331722.1 | 5prime_partial | 184 | 3-557(+) |
Amino Acid sequence : | |||
PRNRPRRGRDARPHVVPHRIRPLPAIQGRQDHRQPPHDHPDRRPHRNPNRARRRGPLVLLQHLLHAGPRRRRHRSRQRRRLRLEGGDSPGILVVHRARARLGPRRRTGSDRRRRRRCNAV DSRGGEGGGGVREEREAAGSELHRQRRISDRVDDYQRWIEGESNEVYEDEGEIGGRFGGDDDWR* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 21,634.800 | ||
Theoretical pI: | 11.803 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 99.311 | ||
aromaticity | 0.027 | ||
GRAVY | -1.653 | ||
Secondary Structure Fraction | |||
Helix | 0.168 | ||
turn | 0.266 | ||
sheet | 0.174 |