Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331735.1 | internal | 228 | 3-686(+) |
Amino Acid sequence : | |||
LQSINGTNSDFPAYSSRLKQILSTSQLKLNNLASANDAGKVFGWISGIAAAHLPLWLVLLIGSLLGLIGYGVQFLFLTNQISSLSYWHFFFLTVLAGNGICWINTVCYIITIRNFPFDRQ IAVGLSTSYVGLSAKIYTDIVDVAAPDSPSERAKMFLLLNSVLPLLVCIVVSPLARDVCVGKSKKLTRGFFTMFVISVITGFFAGITSMKKVASGILPSYMILAGMFV | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 24,748.998 | ||
Theoretical pI: | 9.485 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32680 | ||
Instability index: | 26.834 | ||
aromaticity | 0.118 | ||
GRAVY | 0.747 | ||
Secondary Structure Fraction | |||
Helix | 0.430 | ||
turn | 0.263 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331735.1 | internal | 228 | 3-686(+) |
Amino Acid sequence : | |||
LQSINGTNSDFPAYSSRLKQILSTSQLKLNNLASANDAGKVFGWISGIAAAHLPLWLVLLIGSLLGLIGYGVQFLFLTNQISSLSYWHFFFLTVLAGNGICWINTVCYIITIRNFPFDRQ IAVGLSTSYVGLSAKIYTDIVDVAAPDSPSERAKMFLLLNSVLPLLVCIVVSPLARDVCVGKSKKLTRGFFTMFVISVITGFFAGITSMKKVASGILPSYMILAGMFV | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 24,748.998 | ||
Theoretical pI: | 9.485 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32680 | ||
Instability index: | 26.834 | ||
aromaticity | 0.118 | ||
GRAVY | 0.747 | ||
Secondary Structure Fraction | |||
Helix | 0.430 | ||
turn | 0.263 | ||
sheet | 0.237 |