| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331735.1 | internal | 228 | 3-686(+) |
Amino Acid sequence : | |||
| LQSINGTNSDFPAYSSRLKQILSTSQLKLNNLASANDAGKVFGWISGIAAAHLPLWLVLLIGSLLGLIGYGVQFLFLTNQISSLSYWHFFFLTVLAGNGICWINTVCYIITIRNFPFDRQ IAVGLSTSYVGLSAKIYTDIVDVAAPDSPSERAKMFLLLNSVLPLLVCIVVSPLARDVCVGKSKKLTRGFFTMFVISVITGFFAGITSMKKVASGILPSYMILAGMFV | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 24,748.998 | ||
| Theoretical pI: | 9.485 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32680 | ||
| Instability index: | 26.834 | ||
| aromaticity | 0.118 | ||
| GRAVY | 0.747 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.263 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331735.1 | internal | 228 | 3-686(+) |
Amino Acid sequence : | |||
| LQSINGTNSDFPAYSSRLKQILSTSQLKLNNLASANDAGKVFGWISGIAAAHLPLWLVLLIGSLLGLIGYGVQFLFLTNQISSLSYWHFFFLTVLAGNGICWINTVCYIITIRNFPFDRQ IAVGLSTSYVGLSAKIYTDIVDVAAPDSPSERAKMFLLLNSVLPLLVCIVVSPLARDVCVGKSKKLTRGFFTMFVISVITGFFAGITSMKKVASGILPSYMILAGMFV | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 24,748.998 | ||
| Theoretical pI: | 9.485 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32680 | ||
| Instability index: | 26.834 | ||
| aromaticity | 0.118 | ||
| GRAVY | 0.747 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.263 | ||
| sheet | 0.237 | ||