| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331740.1 | internal | 263 | 1-789(+) |
Amino Acid sequence : | |||
| LQMSVVLSFGGQLPVIKVGRMAGQFAKPRSDPFEEKDGVKLPSYKGDNINGDTFDEKSRIPDPNRMIRAYCQAASTLNLLRAFATGGYAAMQRVTQWNLDFVEHSEQGDRYQELAHRVDE ALGFMEAAGLTIDHPVMSTTEFWTSHECLLLPYEQALTRKDSTSGLYYGCSAHMLWVGERTRQLDGAHVEFLRGVSNPLGIKVSQKMDPNELTKLVDILNPTNKPGRITVIVRMGAENMR VKLPHLIRAVRRAGQIVTWVCDP | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 13,921.450 | ||
| Theoretical pI: | 6.557 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 42.964 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.288 | ||
| sheet | 0.160 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331740.1 | 5prime_partial | 125 | 789-412(-) |
Amino Acid sequence : | |||
| RVTYPSYNLSGSSDCPDQMRKLNSHVLSTHSNDDCDSPRLVGGIQDVDEFSEFIGIHLLAHLDTKRIGNSSQEFNVGTVELPSTFTNPKHVGRTAIVETRSRIFPGECLFIRQQQALVRG PKFSC* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,921.450 | ||
| Theoretical pI: | 6.557 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 42.964 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.288 | ||
| sheet | 0.160 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331740.1 | internal | 263 | 1-789(+) |
Amino Acid sequence : | |||
| LQMSVVLSFGGQLPVIKVGRMAGQFAKPRSDPFEEKDGVKLPSYKGDNINGDTFDEKSRIPDPNRMIRAYCQAASTLNLLRAFATGGYAAMQRVTQWNLDFVEHSEQGDRYQELAHRVDE ALGFMEAAGLTIDHPVMSTTEFWTSHECLLLPYEQALTRKDSTSGLYYGCSAHMLWVGERTRQLDGAHVEFLRGVSNPLGIKVSQKMDPNELTKLVDILNPTNKPGRITVIVRMGAENMR VKLPHLIRAVRRAGQIVTWVCDP | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 13,921.450 | ||
| Theoretical pI: | 6.557 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 42.964 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.288 | ||
| sheet | 0.160 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331740.1 | 5prime_partial | 125 | 789-412(-) |
Amino Acid sequence : | |||
| RVTYPSYNLSGSSDCPDQMRKLNSHVLSTHSNDDCDSPRLVGGIQDVDEFSEFIGIHLLAHLDTKRIGNSSQEFNVGTVELPSTFTNPKHVGRTAIVETRSRIFPGECLFIRQQQALVRG PKFSC* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,921.450 | ||
| Theoretical pI: | 6.557 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 42.964 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.425 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.288 | ||
| sheet | 0.160 | ||