Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331746.1 | complete | 239 | 48-767(+) |
Amino Acid sequence : | |||
MAFAARLLSRSSRQVYDGQSVLRSEYAIPARSFAKGAGGAPPPSKGDSGAPPARPASKGDEMLKGIFLEIKNKFETAMGILRKEKITIDPEDPAAVAHYAKVMKTVREKADLFSESQKIK HTIETKTEGIQDVRTYLVIMMGIRIRMGLVDELGAEAMMMDALDKVEEQLKKPLMRNDKKGMELLKAEFDKVNQKLGIRQEDLPKLEEQVGLKIAKAQLEELKKDAIEAMETQKKREEI* | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 11,244.893 | ||
Theoretical pI: | 7.903 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 63.423 | ||
aromaticity | 0.078 | ||
GRAVY | 0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.282 | ||
sheet | 0.340 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331746.1 | 3prime_partial | 103 | 310-2(-) |
Amino Acid sequence : | |||
MVIFSFLRIPMAVSNLFLISRNIPFNISSPFEAGRAGGAPLSPLEGGGAPPAPLAKERAGIAYSDRRTLCPSYTWREDLESKRAAKAIVELEERLTDLSLLIQ | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,244.893 | ||
Theoretical pI: | 7.903 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 63.423 | ||
aromaticity | 0.078 | ||
GRAVY | 0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.282 | ||
sheet | 0.340 |