| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331760.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGSRAGM | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 14,013.995 | ||
| Theoretical pI: | 5.886 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 42.466 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.291 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331760.1 | 5prime_partial | 150 | 3-455(+) |
Amino Acid sequence : | |||
| SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 14,013.995 | ||
| Theoretical pI: | 5.886 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 42.466 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.291 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331760.1 | complete | 134 | 556-152(-) |
Amino Acid sequence : | |||
| MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,013.995 | ||
| Theoretical pI: | 5.886 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 42.466 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.291 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331760.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGSRAGM | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 14,013.995 | ||
| Theoretical pI: | 5.886 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 42.466 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.291 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331760.1 | 5prime_partial | 150 | 3-455(+) |
Amino Acid sequence : | |||
| SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 14,013.995 | ||
| Theoretical pI: | 5.886 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 42.466 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.291 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331760.1 | complete | 134 | 556-152(-) |
Amino Acid sequence : | |||
| MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,013.995 | ||
| Theoretical pI: | 5.886 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 42.466 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.291 | ||
| sheet | 0.269 | ||