Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331770.1 | 5prime_partial | 183 | 1-552(+) |
Amino Acid sequence : | |||
KKPGEYEPAQKPEPADSNYARAQAARRTMIYVHSKMMIVDDEYIIVGSANINQRSMEGSRDSEIAMGAYQPYHLSKGQQPARGEVHGFRMALWYEHAGMLHNSFSLPENVECMRKMNQIG GNNWDLFSRDELEQDLPGHLLSYPVAVAEDGTITHFPGMENFPDTKAPILGTKSAYYPPILTT* | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 20,577.962 | ||
Theoretical pI: | 5.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 25900 | ||
Instability index: | 49.321 | ||
aromaticity | 0.093 | ||
GRAVY | -0.606 | ||
Secondary Structure Fraction | |||
Helix | 0.246 | ||
turn | 0.268 | ||
sheet | 0.279 |