Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331774.1 | complete | 183 | 43-594(+) |
Amino Acid sequence : | |||
MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPIEGPVDGLKSVLLNSTPVLDTEGNTNISGVTVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRTITSANIDRLRFTFGVQA LVETTSKGDRNPSEVCLLVQIQRNGGWVTEKDITIKGKTTSQYLASVVMGNLPPRPFISGCAG* | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 11,738.452 | ||
Theoretical pI: | 5.527 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 44.986 | ||
aromaticity | 0.071 | ||
GRAVY | 0.455 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.389 | ||
sheet | 0.186 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331774.1 | complete | 113 | 368-27(-) |
Amino Acid sequence : | |||
MFADVMVRVIGVSYFTSVPSTVSEPEDSNPSGGVCSCSPARNTTVTPDMLVFPSVSSTGVLFSSTLFKPSTGPSIGPSLMASITLSNCVDFRLSFASRGVCPLLLPLPIPHAP* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 11,738.452 | ||
Theoretical pI: | 5.527 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 44.986 | ||
aromaticity | 0.071 | ||
GRAVY | 0.455 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.389 | ||
sheet | 0.186 |