| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331803.1 | 5prime_partial | 187 | 3-566(+) |
Amino Acid sequence : | |||
| NAFMGNSGETRYGISKVGEEFMAGVLDHLPSILAFTAPVPNSYDRIQPNTWSGAYLCWGMENREAPLRAACPPGTPDGSVSNFEIKVFDGCANPHLGLAAIMAAGIDGLRRHLTLPEPID DNPDNVKDKVRRLPKSLSESVEALEGDTVLRDLIGEKLLVAIKGVRKAEIKYYSANKDAWNNLIYRY* | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 20,519.106 | ||
| Theoretical pI: | 5.661 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 34.547 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.278 | ||
| sheet | 0.278 | ||