Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331805.1 | 5prime_partial | 233 | 2-703(+) |
Amino Acid sequence : | |||
NKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTK VDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGKIPDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKTAAYGHFGRDDPDFTWETVKVLKPKA* | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 12,108.653 | ||
Theoretical pI: | 4.432 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 45.602 | ||
aromaticity | 0.046 | ||
GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.222 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331805.1 | 3prime_partial | 108 | 325-2(-) |
Amino Acid sequence : | |||
MSTPATICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLV | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,108.653 | ||
Theoretical pI: | 4.432 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 45.602 | ||
aromaticity | 0.046 | ||
GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.222 | ||
sheet | 0.231 |