| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331805.1 | 5prime_partial | 233 | 2-703(+) |
Amino Acid sequence : | |||
| NKTCPWLRPDGKTQVTVEYKNEDGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTK VDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGKIPDKDILALIKENFDFRPGMIAINLDLKRGGNFRYQKTAAYGHFGRDDPDFTWETVKVLKPKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 12,108.653 | ||
| Theoretical pI: | 4.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 45.602 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.222 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331805.1 | 3prime_partial | 108 | 325-2(-) |
Amino Acid sequence : | |||
| MSTPATICVDNDLPTSETGISMWTTNHETPRWVEVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLVVLRGDEDCMNSHRNHGTILVFVLDGDLCLTIGSQPWASLV | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,108.653 | ||
| Theoretical pI: | 4.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 45.602 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.222 | ||
| sheet | 0.231 | ||