Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331806.1 | 5prime_partial | 157 | 2-475(+) |
Amino Acid sequence : | |||
PTLSSPPPRHQKTSARMGRVRTKTVKKSSRQVIERYYGKMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDESAIKTDRIEVDQETVD LLESLGMKDLPGIVLKEDDGAIGVPQVSYGRGGGRRY* | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 17,871.448 | ||
Theoretical pI: | 10.031 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 53.983 | ||
aromaticity | 0.045 | ||
GRAVY | -0.750 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.223 | ||
sheet | 0.217 |