| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331808.1 | 3prime_partial | 202 | 75-680(+) |
Amino Acid sequence : | |||
| MLNSVKIRKEDMNKLVMNFLVSEGYVEAAENFQLESGTEPDIDLATITDRMAVKRAVQNGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKIEEALEFAQEELAPRGEENQ CFLEELERTVALLAFEDVSNCPVGELLNISQRLKTASEVNAAILTSQSHEKDPKLPSLLKMLIWAQNLLDEKASYPHMHDLS | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,901.732 | ||
| Theoretical pI: | 4.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 45.803 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.198 | ||
| sheet | 0.371 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331808.1 | 3prime_partial | 202 | 75-680(+) |
Amino Acid sequence : | |||
| MLNSVKIRKEDMNKLVMNFLVSEGYVEAAENFQLESGTEPDIDLATITDRMAVKRAVQNGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKIEEALEFAQEELAPRGEENQ CFLEELERTVALLAFEDVSNCPVGELLNISQRLKTASEVNAAILTSQSHEKDPKLPSLLKMLIWAQNLLDEKASYPHMHDLS | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,901.732 | ||
| Theoretical pI: | 4.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 45.803 | ||
| aromaticity | 0.050 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.198 | ||
| sheet | 0.371 | ||