Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331820.1 | complete | 195 | 145-732(+) |
Amino Acid sequence : | |||
MERDFMGLNAKDSAVKEEVFEGGCEDSGYARSSGLPWPSSNKVSALPQFMSLRGKQDEKPPKNGQPAYSVHPFSMKQQFLGRNTHPASYVPSQLNIFYGGTVNVFDDISPEKAQAIMLLA GNMYVQSKPKLHMQAPASKLPAADEPLVNQSMNTPPCSGLPSPMSVSSHPIDQSGANNDEIKVCNTTLXHNTDSP* | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,010.403 | ||
Theoretical pI: | 5.926 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 65.040 | ||
aromaticity | 0.067 | ||
GRAVY | -0.572 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.356 | ||
sheet | 0.232 |