| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331820.1 | complete | 195 | 145-732(+) |
Amino Acid sequence : | |||
| MERDFMGLNAKDSAVKEEVFEGGCEDSGYARSSGLPWPSSNKVSALPQFMSLRGKQDEKPPKNGQPAYSVHPFSMKQQFLGRNTHPASYVPSQLNIFYGGTVNVFDDISPEKAQAIMLLA GNMYVQSKPKLHMQAPASKLPAADEPLVNQSMNTPPCSGLPSPMSVSSHPIDQSGANNDEIKVCNTTLXHNTDSP* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 21,010.403 | ||
| Theoretical pI: | 5.926 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 65.040 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.572 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.356 | ||
| sheet | 0.232 | ||