Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331821.1 | internal | 238 | 1-714(+) |
Amino Acid sequence : | |||
AIYRKPCLPHWLAVALLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLH TQGVEFGSRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDRLFVQATSST | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 27,229.583 | ||
Theoretical pI: | 9.578 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
Instability index: | 47.748 | ||
aromaticity | 0.105 | ||
GRAVY | 0.057 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.235 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331821.1 | internal | 238 | 1-714(+) |
Amino Acid sequence : | |||
AIYRKPCLPHWLAVALLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLH TQGVEFGSRPRNVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDRLFVQATSST | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 27,229.583 | ||
Theoretical pI: | 9.578 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
Instability index: | 47.748 | ||
aromaticity | 0.105 | ||
GRAVY | 0.057 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.235 | ||
sheet | 0.252 |