Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331826.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
PFFSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSP ANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEA ADPFEYCDLXNTTT | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 14,677.993 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 98.833 | ||
aromaticity | 0.017 | ||
GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
Helix | 0.198 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331826.1 | 5prime_partial | 195 | 3-590(+) |
Amino Acid sequence : | |||
PSSPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPP LISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 14,677.993 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 98.833 | ||
aromaticity | 0.017 | ||
GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
Helix | 0.198 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331826.1 | 5prime_partial | 158 | 763-287(-) |
Amino Acid sequence : | |||
GRSVXQIAILKWISRFLSSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDP VVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 14,677.993 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 98.833 | ||
aromaticity | 0.017 | ||
GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
Helix | 0.198 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331826.1 | 5prime_partial | 121 | 1-366(+) |
Amino Acid sequence : | |||
TLLLLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLP R* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 14,677.993 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 98.833 | ||
aromaticity | 0.017 | ||
GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
Helix | 0.198 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331826.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
PFFSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSP ANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEA ADPFEYCDLXNTTT | |||
Physicochemical properties | |||
Number of amino acids: | 254 | ||
Molecular weight: | 14,677.993 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 98.833 | ||
aromaticity | 0.017 | ||
GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
Helix | 0.198 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331826.1 | 5prime_partial | 195 | 3-590(+) |
Amino Acid sequence : | |||
PSSPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPP LISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 14,677.993 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 98.833 | ||
aromaticity | 0.017 | ||
GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
Helix | 0.198 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331826.1 | 5prime_partial | 158 | 763-287(-) |
Amino Acid sequence : | |||
GRSVXQIAILKWISRFLSSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDP VVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 14,677.993 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 98.833 | ||
aromaticity | 0.017 | ||
GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
Helix | 0.198 | ||
turn | 0.231 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331826.1 | 5prime_partial | 121 | 1-366(+) |
Amino Acid sequence : | |||
TLLLLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLP R* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 14,677.993 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 98.833 | ||
aromaticity | 0.017 | ||
GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
Helix | 0.198 | ||
turn | 0.231 | ||
sheet | 0.240 |