| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331826.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
| PFFSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSP ANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEA ADPFEYCDLXNTTT | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 14,677.993 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 98.833 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.231 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331826.1 | 5prime_partial | 195 | 3-590(+) |
Amino Acid sequence : | |||
| PSSPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPP LISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 14,677.993 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 98.833 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.231 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331826.1 | 5prime_partial | 158 | 763-287(-) |
Amino Acid sequence : | |||
| GRSVXQIAILKWISRFLSSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDP VVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 14,677.993 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 98.833 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.231 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331826.1 | 5prime_partial | 121 | 1-366(+) |
Amino Acid sequence : | |||
| TLLLLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLP R* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 14,677.993 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 98.833 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.231 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331826.1 | internal | 254 | 2-763(+) |
Amino Acid sequence : | |||
| PFFSYISSAAGIMDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSP ANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEA ADPFEYCDLXNTTT | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 14,677.993 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 98.833 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.231 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331826.1 | 5prime_partial | 195 | 3-590(+) |
Amino Acid sequence : | |||
| PSSPISPPPPELWIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPP LISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 14,677.993 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 98.833 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.231 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331826.1 | 5prime_partial | 158 | 763-287(-) |
Amino Acid sequence : | |||
| GRSVXQIAILKWISRFLSSNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDP VVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 14,677.993 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 98.833 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.231 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331826.1 | 5prime_partial | 121 | 1-366(+) |
Amino Acid sequence : | |||
| TLLLLYLLRRRNYGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLP R* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 14,677.993 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 98.833 | ||
| aromaticity | 0.017 | ||
| GRAVY | -1.394 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.231 | ||
| sheet | 0.240 | ||