| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331829.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
| RSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGH LTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAK | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 25,445.502 | ||
| Theoretical pI: | 5.061 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 36.569 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.203 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331829.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
| RSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGH LTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAK | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 25,445.502 | ||
| Theoretical pI: | 5.061 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 36.569 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.203 | ||
| sheet | 0.220 | ||