| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331831.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| LYSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKDKAAAH LKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTDCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPRST | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 12,284.844 | ||
| Theoretical pI: | 8.162 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11500 | ||
| Instability index: | 65.348 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.319 | ||
| sheet | 0.150 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331831.1 | 5prime_partial | 113 | 661-320(-) |
Amino Acid sequence : | |||
| GASGDNIERCSSSAPPVLGRWSINSLLSCSNRVDCCHKTFDNTKPIIDNLSQWGKAVCGTTSIGHNIQVRCVCLFINTNDKHGCILTRSRNDDLLCTTLQMSRSLILVGENSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,284.844 | ||
| Theoretical pI: | 8.162 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11500 | ||
| Instability index: | 65.348 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.319 | ||
| sheet | 0.150 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331831.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| LYSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWGETGAEYIVESTGVFTDKDKAAAH LKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTDCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPRST | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 12,284.844 | ||
| Theoretical pI: | 8.162 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11500 | ||
| Instability index: | 65.348 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.319 | ||
| sheet | 0.150 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331831.1 | 5prime_partial | 113 | 661-320(-) |
Amino Acid sequence : | |||
| GASGDNIERCSSSAPPVLGRWSINSLLSCSNRVDCCHKTFDNTKPIIDNLSQWGKAVCGTTSIGHNIQVRCVCLFINTNDKHGCILTRSRNDDLLCTTLQMSRSLILVGENSS* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,284.844 | ||
| Theoretical pI: | 8.162 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11500 | ||
| Instability index: | 65.348 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.161 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.319 | ||
| sheet | 0.150 | ||