| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331836.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| SCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHTQGVEFGSRPRNVVFDI FTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDYNYGDFIP LLRPFLKGYLAKCRDLQSRRLAF | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 17,099.506 | ||
| Theoretical pI: | 6.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 49.190 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.184 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331836.1 | 5prime_partial | 152 | 790-332(-) |
Amino Acid sequence : | |||
| KCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHLLLPHPAVVVHHLVGEKWEGH YAPHLAPVLPVHREHHVLPVAREYVEHHVARP* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 17,099.506 | ||
| Theoretical pI: | 6.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 49.190 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.184 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331836.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
| SCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHTQGVEFGSRPRNVVFDI FTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDYNYGDFIP LLRPFLKGYLAKCRDLQSRRLAF | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 17,099.506 | ||
| Theoretical pI: | 6.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 49.190 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.184 | ||
| sheet | 0.289 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331836.1 | 5prime_partial | 152 | 790-332(-) |
Amino Acid sequence : | |||
| KCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHLLLPHPAVVVHHLVGEKWEGH YAPHLAPVLPVHREHHVLPVAREYVEHHVARP* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 17,099.506 | ||
| Theoretical pI: | 6.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 49.190 | ||
| aromaticity | 0.039 | ||
| GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.184 | ||
| sheet | 0.289 | ||