Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331847.1 | complete | 181 | 126-671(+) |
Amino Acid sequence : | |||
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 14,874.916 | ||
Theoretical pI: | 5.608 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 25.914 | ||
aromaticity | 0.053 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.256 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331847.1 | complete | 133 | 449-48(-) |
Amino Acid sequence : | |||
MQFIPRLNNTVPIITINHEYETLSVLEVVPPQWADLVLTPDIPHSEADVLVFNSLHIEANSRNGCNNLSKLELVQDGGLTSSIKTNHQNTHLLLGKKPAKKLCECQPHFPFLLLIPENAR FGEALERETMVSA* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 14,874.916 | ||
Theoretical pI: | 5.608 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 25.914 | ||
aromaticity | 0.053 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.256 | ||
sheet | 0.293 |