| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331848.1 | internal | 179 | 2-538(+) |
Amino Acid sequence : | |||
| ADRTARAFKSMWDAVLDIGRPDTAQEMLIKAEAAYKKADDIWNLRKDDYFVNDEARARYWDDREKARLALEAARKKAEQQTQQDKNAQQQSDTEASRLKYTEEAQKAYERLQTPLEKYTA RQEELNKALKDGKILQADYNTLMAAAKKDYEATLKKPKQSSVRVSAGDRQEDSAHAALL | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 13,637.116 | ||
| Theoretical pI: | 9.038 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 67.057 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.386 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.352 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331848.1 | 5prime_partial | 128 | 539-153(-) |
Amino Acid sequence : | |||
| SAGQHEHCLPDDRPQTPSRWTVSAFSASLHNPFSPPPSACCNPPAGFSRLSVPCSVLPDGRYISPAASAAVRKPSAPLRYISAVTLRYRSAAAHFCPVESAAQPSFGRLQAQDGPFHDHP SNAPALHR* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,637.116 | ||
| Theoretical pI: | 9.038 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 67.057 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.386 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.352 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331848.1 | internal | 179 | 2-538(+) |
Amino Acid sequence : | |||
| ADRTARAFKSMWDAVLDIGRPDTAQEMLIKAEAAYKKADDIWNLRKDDYFVNDEARARYWDDREKARLALEAARKKAEQQTQQDKNAQQQSDTEASRLKYTEEAQKAYERLQTPLEKYTA RQEELNKALKDGKILQADYNTLMAAAKKDYEATLKKPKQSSVRVSAGDRQEDSAHAALL | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 13,637.116 | ||
| Theoretical pI: | 9.038 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 67.057 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.386 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.352 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331848.1 | 5prime_partial | 128 | 539-153(-) |
Amino Acid sequence : | |||
| SAGQHEHCLPDDRPQTPSRWTVSAFSASLHNPFSPPPSACCNPPAGFSRLSVPCSVLPDGRYISPAASAAVRKPSAPLRYISAVTLRYRSAAAHFCPVESAAQPSFGRLQAQDGPFHDHP SNAPALHR* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 13,637.116 | ||
| Theoretical pI: | 9.038 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 67.057 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.386 | ||
Secondary Structure Fraction | |||
| Helix | 0.203 | ||
| turn | 0.352 | ||
| sheet | 0.227 | ||