Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331849.1 | internal | 245 | 736-2(-) |
Amino Acid sequence : | |||
QADYNTLMAAAKKDYEATLKKPKQSSVKVSAGDRQEDSAHAALLTLQAELRTLEKHAGANEKISQQRRDLWKAESQFAVLEEAAQRRQLSAQEKSLLAHKDETLEYKRQLAALGDKVTYQ ERLNALAQQADKFAQQQRAKRAAIDAKSRGLTDRQAEREATEQRLKEQYGDNPLALNNVMSEQKKTWAAEDQLRGNWMAGLKSGWSEWEESATDSMSQVKSAATQTFDGIAQNMAAMLTG SEQNW | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 11,960.372 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 78.084 | ||
aromaticity | 0.091 | ||
GRAVY | 0.112 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.101 | ||
sheet | 0.313 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331849.1 | 5prime_partial | 125 | 3-380(+) |
Amino Acid sequence : | |||
QFCSLPVSIAAIFCAIPSKVCVAALFTCDILSVALSSHSLQPDFRPAIQFPRSWSSAAQVFFCSDMTLFSASGLSPYCSFRRCSVASRSACRSVSPRLFASMAARFARCCCANLSACCAS AFRRS* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 11,960.372 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 78.084 | ||
aromaticity | 0.091 | ||
GRAVY | 0.112 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.101 | ||
sheet | 0.313 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331849.1 | 3prime_partial | 99 | 440-736(+) |
Amino Acid sequence : | |||
MRQQGFLLCRQLATLRRLLQYRELTLRLPQIPALLADFLICSGMLLQRPEFCLKRQQGSMSTVFLTIARRHLHAGLFRLFQRRFIILFRRRHQRVVIRL | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,960.372 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 78.084 | ||
aromaticity | 0.091 | ||
GRAVY | 0.112 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.101 | ||
sheet | 0.313 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331849.1 | internal | 245 | 736-2(-) |
Amino Acid sequence : | |||
QADYNTLMAAAKKDYEATLKKPKQSSVKVSAGDRQEDSAHAALLTLQAELRTLEKHAGANEKISQQRRDLWKAESQFAVLEEAAQRRQLSAQEKSLLAHKDETLEYKRQLAALGDKVTYQ ERLNALAQQADKFAQQQRAKRAAIDAKSRGLTDRQAEREATEQRLKEQYGDNPLALNNVMSEQKKTWAAEDQLRGNWMAGLKSGWSEWEESATDSMSQVKSAATQTFDGIAQNMAAMLTG SEQNW | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 11,960.372 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 78.084 | ||
aromaticity | 0.091 | ||
GRAVY | 0.112 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.101 | ||
sheet | 0.313 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331849.1 | 5prime_partial | 125 | 3-380(+) |
Amino Acid sequence : | |||
QFCSLPVSIAAIFCAIPSKVCVAALFTCDILSVALSSHSLQPDFRPAIQFPRSWSSAAQVFFCSDMTLFSASGLSPYCSFRRCSVASRSACRSVSPRLFASMAARFARCCCANLSACCAS AFRRS* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 11,960.372 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 78.084 | ||
aromaticity | 0.091 | ||
GRAVY | 0.112 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.101 | ||
sheet | 0.313 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331849.1 | 3prime_partial | 99 | 440-736(+) |
Amino Acid sequence : | |||
MRQQGFLLCRQLATLRRLLQYRELTLRLPQIPALLADFLICSGMLLQRPEFCLKRQQGSMSTVFLTIARRHLHAGLFRLFQRRFIILFRRRHQRVVIRL | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,960.372 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 78.084 | ||
aromaticity | 0.091 | ||
GRAVY | 0.112 | ||
Secondary Structure Fraction | |||
Helix | 0.394 | ||
turn | 0.101 | ||
sheet | 0.313 |