Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331852.1	internal	213	2-640(+)
Amino Acid sequence :
IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCNLVTTTTPQSL
Physicochemical properties
Number of amino acids:		213
Molecular weight:		14,013.995
Theoretical pI:		5.886
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		42.466
aromaticity		0.007
GRAVY		0.096
Secondary Structure Fraction
Helix		0.313
turn		0.291
sheet		0.269

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331852.1	5prime_partial	150	3-455(+)
Amino Acid sequence :
SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS*
Physicochemical properties
Number of amino acids:		150
Molecular weight:		14,013.995
Theoretical pI:		5.886
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		42.466
aromaticity		0.007
GRAVY		0.096
Secondary Structure Fraction
Helix		0.313
turn		0.291
sheet		0.269

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331852.1	complete	134	556-152(-)
Amino Acid sequence :
MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		14,013.995
Theoretical pI:		5.886
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		42.466
aromaticity		0.007
GRAVY		0.096
Secondary Structure Fraction
Helix		0.313
turn		0.291
sheet		0.269

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331852.1	internal	213	2-640(+)
Amino Acid sequence :
IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCNLVTTTTPQSL
Physicochemical properties
Number of amino acids:		213
Molecular weight:		14,013.995
Theoretical pI:		5.886
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		42.466
aromaticity		0.007
GRAVY		0.096
Secondary Structure Fraction
Helix		0.313
turn		0.291
sheet		0.269

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331852.1	5prime_partial	150	3-455(+)
Amino Acid sequence :
SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS*
Physicochemical properties
Number of amino acids:		150
Molecular weight:		14,013.995
Theoretical pI:		5.886
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		42.466
aromaticity		0.007
GRAVY		0.096
Secondary Structure Fraction
Helix		0.313
turn		0.291
sheet		0.269

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331852.1	complete	134	556-152(-)
Amino Acid sequence :
MRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDID APFGGVEAVGLEGT*
Physicochemical properties
Number of amino acids:		134
Molecular weight:		14,013.995
Theoretical pI:		5.886
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		0 0
Instability index:		42.466
aromaticity		0.007
GRAVY		0.096
Secondary Structure Fraction
Helix		0.313
turn		0.291
sheet		0.269