| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331856.1 | 3prime_partial | 227 | 77-757(+) |
Amino Acid sequence : | |||
| MALSNTAAFSSKSVIQPQTLLPAAALHSTSFSSPSTVRRHISAVHAAEPAKAPVVATKSAPPSSKWTPETWKTKNALQLPEYPDEAELEAVLKTMEAYPPLVFAGEVRSLEERLAEAAIG KAFLLQGGDCAESFKEFSANNIRDTFRILLQMSVVLSFGGQLPVIKVGRMAGQFAKPRSDAFEEKDGVKLPSYKGDNINGDTFDEKSRIPDPNRMIRAYCQAASTLN | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 13,239.178 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 128.768 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.993 | ||
Secondary Structure Fraction | |||
| Helix | 0.181 | ||
| turn | 0.414 | ||
| sheet | 0.121 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331856.1 | 5prime_partial | 116 | 3-353(+) |
Amino Acid sequence : | |||
| ISTSLIQSLSLTHTYILTNTGKTQQWRCLTPPPSLPNRSFSPKPSYPPPPSTPHHSPPPPPSVATSPPCMRRSLQRRRSSPPNLRRHPPSGRRRRGRRRTLCSCRSTPMRLSWRLF* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,239.178 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 128.768 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.993 | ||
Secondary Structure Fraction | |||
| Helix | 0.181 | ||
| turn | 0.414 | ||
| sheet | 0.121 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331856.1 | 3prime_partial | 227 | 77-757(+) |
Amino Acid sequence : | |||
| MALSNTAAFSSKSVIQPQTLLPAAALHSTSFSSPSTVRRHISAVHAAEPAKAPVVATKSAPPSSKWTPETWKTKNALQLPEYPDEAELEAVLKTMEAYPPLVFAGEVRSLEERLAEAAIG KAFLLQGGDCAESFKEFSANNIRDTFRILLQMSVVLSFGGQLPVIKVGRMAGQFAKPRSDAFEEKDGVKLPSYKGDNINGDTFDEKSRIPDPNRMIRAYCQAASTLN | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 13,239.178 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 128.768 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.993 | ||
Secondary Structure Fraction | |||
| Helix | 0.181 | ||
| turn | 0.414 | ||
| sheet | 0.121 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331856.1 | 5prime_partial | 116 | 3-353(+) |
Amino Acid sequence : | |||
| ISTSLIQSLSLTHTYILTNTGKTQQWRCLTPPPSLPNRSFSPKPSYPPPPSTPHHSPPPPPSVATSPPCMRRSLQRRRSSPPNLRRHPPSGRRRRGRRRTLCSCRSTPMRLSWRLF* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,239.178 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 128.768 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.993 | ||
Secondary Structure Fraction | |||
| Helix | 0.181 | ||
| turn | 0.414 | ||
| sheet | 0.121 | ||