Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331858.1 | complete | 181 | 56-601(+) |
Amino Acid sequence : | |||
MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEE* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 14,628.485 | ||
Theoretical pI: | 6.638 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
Instability index: | 45.400 | ||
aromaticity | 0.084 | ||
GRAVY | -0.233 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.198 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331858.1 | 5prime_partial | 131 | 602-207(-) |
Amino Acid sequence : | |||
VILLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYL PENHIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,628.485 | ||
Theoretical pI: | 6.638 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
Instability index: | 45.400 | ||
aromaticity | 0.084 | ||
GRAVY | -0.233 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.198 | ||
sheet | 0.214 |