| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331858.1 | complete | 181 | 56-601(+) |
Amino Acid sequence : | |||
| MKERPHITITSPIDTYHTHRQISDSQEYVKDTCTHILKSKPHMKSMLNYSSNSSKPTQCDSQGDNGRLAQSLASPSTPEKPNASGSTLPCPCGTPPQPQPLTHRPPREKRRRPPSSQSCG SKTQHTHTPAGGKPPPACRSASSTPFQYGTLSYPDYPLLSTLLQRCSLFSTWRNRPWTPEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 14,628.485 | ||
| Theoretical pI: | 6.638 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
| Instability index: | 45.400 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.198 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331858.1 | 5prime_partial | 131 | 602-207(-) |
Amino Acid sequence : | |||
| VILLESMVDFATSKIGNNVEAVSTEADSPDRKVYRIERVSRKPSDKPVVVCHQQEYEYAVFYCHKTETTVAYDVSLVGAGGSKAEAVAVCHRDTAEWNPKHLAFQVLKVKPGTVPVCHYL PENHIVWVSKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,628.485 | ||
| Theoretical pI: | 6.638 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
| Instability index: | 45.400 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.233 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.198 | ||
| sheet | 0.214 | ||