Acc_NO	ORF type	length	start-end position (strand +/-)
>DY331867.1	5prime_partial	131	2-397(+)
Amino Acid sequence :
LLAPRVASKDVTINGFDVLAGTVVMINAWAISRDEAIWNDAKKFQPERFLNTPIDFKGTDFKFIPFGAGRRRCPGIAYGEATAELLLANIVHKFNWKLPGEAQGGKLGINETPGIAVGRA TPLYALTVKSA*
Physicochemical properties
Number of amino acids:		131
Molecular weight:		14,185.229
Theoretical pI:		9.415
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19480
Instability index:		20.192
aromaticity		0.099
GRAVY		0.024
Secondary Structure Fraction
Helix		0.321
turn		0.237
sheet		0.267