| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331868.1 | internal | 185 | 2-556(+) |
Amino Acid sequence : | |||
| LSRLQHSISMGAEIPGIVKLKCSVKNYDWGKPGKESTVARLYARNSGHEVDDEEPYAEFWMGTHDSGPSYVVAAAEATAGPPESGVEVKNACDREKGDLVSLKDWIERNPTVLGDKVLQK WGPSLPFLFKVLSVLKALSIQAHPDKDLAAILHKEQPEMYKDGNHKPEMALALTEFEALCGFVGL | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 11,432.071 | ||
| Theoretical pI: | 11.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 90.969 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.574 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.337 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331868.1 | 5prime_partial | 101 | 3-308(+) |
Amino Acid sequence : | |||
| SLDSNIPFPWAPKFQESSNSSAPSKTMTGESLGRNPLWRGCMQGTVVTRSTMKNRTLSFGWGLTTPVLLTSLQRRKRLPDRRSPAWRSRMPVIVRREISSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,432.071 | ||
| Theoretical pI: | 11.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 90.969 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.574 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.337 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331868.1 | internal | 185 | 2-556(+) |
Amino Acid sequence : | |||
| LSRLQHSISMGAEIPGIVKLKCSVKNYDWGKPGKESTVARLYARNSGHEVDDEEPYAEFWMGTHDSGPSYVVAAAEATAGPPESGVEVKNACDREKGDLVSLKDWIERNPTVLGDKVLQK WGPSLPFLFKVLSVLKALSIQAHPDKDLAAILHKEQPEMYKDGNHKPEMALALTEFEALCGFVGL | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 11,432.071 | ||
| Theoretical pI: | 11.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 90.969 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.574 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.337 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331868.1 | 5prime_partial | 101 | 3-308(+) |
Amino Acid sequence : | |||
| SLDSNIPFPWAPKFQESSNSSAPSKTMTGESLGRNPLWRGCMQGTVVTRSTMKNRTLSFGWGLTTPVLLTSLQRRKRLPDRRSPAWRSRMPVIVRREISSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,432.071 | ||
| Theoretical pI: | 11.939 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22000 | ||
| Instability index: | 90.969 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.574 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.337 | ||
| sheet | 0.188 | ||