| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331873.1 | internal | 192 | 1-576(+) |
Amino Acid sequence : | |||
| SPIYDEKREPTHLTSIVDLGRTGSTDPLQIVANNLTIMYSEMVRGNNDVFDFMGQPYRLGTPVSPGAGASERGSHTSIHIFVGDSRQPRKENMGNFYSAGRDPLFYCHHANVDRMWTVWQ KLPSTVIPKKTIDDPDFLNATFLLYDENGKLVRVSVKDTIDNRKMGYDFERIDLPWEDYRPPRQTAKAKINR | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 15,436.198 | ||
| Theoretical pI: | 11.799 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 89.889 | ||
| aromaticity | 0.038 | ||
| GRAVY | -1.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.176 | ||
| turn | 0.275 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331873.1 | 5prime_partial | 131 | 3-398(+) |
Amino Acid sequence : | |||
| SNLRRETRADSPHLHRRPRTYRQHRPPANRCQQSHHHVLRNGQRKQRCVRFHGTTLPPWNSGEPRRRSLRARVPHLYPHLRRRQPPAEEGEHGQLLLRGAGPAFLLPPRQRRPHVDGLAE APVNRHPEEND* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 15,436.198 | ||
| Theoretical pI: | 11.799 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 89.889 | ||
| aromaticity | 0.038 | ||
| GRAVY | -1.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.176 | ||
| turn | 0.275 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331873.1 | internal | 192 | 1-576(+) |
Amino Acid sequence : | |||
| SPIYDEKREPTHLTSIVDLGRTGSTDPLQIVANNLTIMYSEMVRGNNDVFDFMGQPYRLGTPVSPGAGASERGSHTSIHIFVGDSRQPRKENMGNFYSAGRDPLFYCHHANVDRMWTVWQ KLPSTVIPKKTIDDPDFLNATFLLYDENGKLVRVSVKDTIDNRKMGYDFERIDLPWEDYRPPRQTAKAKINR | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 15,436.198 | ||
| Theoretical pI: | 11.799 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 89.889 | ||
| aromaticity | 0.038 | ||
| GRAVY | -1.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.176 | ||
| turn | 0.275 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331873.1 | 5prime_partial | 131 | 3-398(+) |
Amino Acid sequence : | |||
| SNLRRETRADSPHLHRRPRTYRQHRPPANRCQQSHHHVLRNGQRKQRCVRFHGTTLPPWNSGEPRRRSLRARVPHLYPHLRRRQPPAEEGEHGQLLLRGAGPAFLLPPRQRRPHVDGLAE APVNRHPEEND* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 15,436.198 | ||
| Theoretical pI: | 11.799 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 89.889 | ||
| aromaticity | 0.038 | ||
| GRAVY | -1.466 | ||
Secondary Structure Fraction | |||
| Helix | 0.176 | ||
| turn | 0.275 | ||
| sheet | 0.221 | ||