| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331875.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
| RSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGH LTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIF HXHPSGRFVIGGPHGDAGLTGRKIIIDTY | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 29,395.919 | ||
| Theoretical pI: | 5.331 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 32.173 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.209 | ||
| sheet | 0.201 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331875.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
| RSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGH LTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIF HXHPSGRFVIGGPHGDAGLTGRKIIIDTY | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 29,395.919 | ||
| Theoretical pI: | 5.331 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 32.173 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.393 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.209 | ||
| sheet | 0.201 | ||