Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331892.1 | 5prime_partial | 160 | 675-193(-) |
Amino Acid sequence : | |||
ADQDGSGFIDDKELQRALSSYNQSFGLRTVHLLMYLFTNTNTRKIGPKEFTQVFYSLQSWRAIFERFDRDRSGKIDANELREALLSLGFSVSPVVLELLVSKFDKSGGKNKAIEYDNFIE CCLTVKGLTEKFKEKDTGFTGSATFTYESFMLTVLPFLIA* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 18,172.466 | ||
Theoretical pI: | 5.925 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 40.764 | ||
aromaticity | 0.131 | ||
GRAVY | -0.198 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.213 | ||
sheet | 0.250 |