| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331892.1 | 5prime_partial | 160 | 675-193(-) |
Amino Acid sequence : | |||
| ADQDGSGFIDDKELQRALSSYNQSFGLRTVHLLMYLFTNTNTRKIGPKEFTQVFYSLQSWRAIFERFDRDRSGKIDANELREALLSLGFSVSPVVLELLVSKFDKSGGKNKAIEYDNFIE CCLTVKGLTEKFKEKDTGFTGSATFTYESFMLTVLPFLIA* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,172.466 | ||
| Theoretical pI: | 5.925 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 40.764 | ||
| aromaticity | 0.131 | ||
| GRAVY | -0.198 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.213 | ||
| sheet | 0.250 | ||