| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331896.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
| LAVALLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHTQGVEFGSRPR NVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDXH YGDFIPLL | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 14,729.768 | ||
| Theoretical pI: | 6.467 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 44.777 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.177 | ||
| sheet | 0.285 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331896.1 | 5prime_partial | 131 | 745-350(-) |
Amino Acid sequence : | |||
| EQGDEIAVVXIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHLLLPHPAVVVHHLVGEKWEGHYAPHLAPVLPVHREHHVLPVA REYVEHHVARP* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,729.768 | ||
| Theoretical pI: | 6.467 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 44.777 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.177 | ||
| sheet | 0.285 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331896.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
| LAVALLSCANTIISHFSLPLPLKICTFILFSFPLLPLIIGSARTGAANPRPPGPTPVPIFGNWLQVGNDLNHRLLAAMSQTYGPLFMLKLGSKNLVIVSSPDLADQVLHTQGVEFGSRPR NVVFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDXH YGDFIPLL | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 14,729.768 | ||
| Theoretical pI: | 6.467 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 44.777 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.177 | ||
| sheet | 0.285 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331896.1 | 5prime_partial | 131 | 745-350(-) |
Amino Acid sequence : | |||
| EQGDEIAVVXIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHLLLPHPAVVVHHLVGEKWEGHYAPHLAPVLPVHREHHVLPVA REYVEHHVARP* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,729.768 | ||
| Theoretical pI: | 6.467 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 44.777 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.177 | ||
| sheet | 0.285 | ||