Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331900.1 | complete | 122 | 89-457(+) |
Amino Acid sequence : | |||
MAARLQQLQSKACQAKQYVTKHGTAYYKQLMEQNKQYVKEPPTVETCHELAKQLWYTRLASIPGRTESFWNEVNYVKNMWKHRHDLKVEDAGIAALFGLECYAWFCAGEIVGRGFTITGY YP* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 14,172.086 | ||
Theoretical pI: | 8.870 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35660 | ||
Instability index: | 49.893 | ||
aromaticity | 0.139 | ||
GRAVY | -0.501 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.156 | ||
sheet | 0.270 |