| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331919.1 | internal | 237 | 3-713(+) |
Amino Acid sequence : | |||
| PPRFCSPFRIMSSKQTYRVCFCFRRRFRLAASEAPADVKDLFATYSENGVMEAHQLQRFLHEVQDQKAATVEEAQAIIDSFKHLNIFHRRGFNLEGFFKYLFADVNEPLDAKLGVHHDMT APLSHYYIYTGHNSYLTGNQLSSDCSDVPIINALHRGVRVIELDIWPNSTGDNVNVLHGRTLTTPVELIKCLKSIKENAFVASEYPVVITLEDHLTPDLQAKVAEMINQTFGDMILA | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 14,541.438 | ||
| Theoretical pI: | 5.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 55.758 | ||
| aromaticity | 0.038 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.205 | ||
| sheet | 0.402 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331919.1 | 3prime_partial | 132 | 398-3(-) |
Amino Acid sequence : | |||
| MASVYIIMGKRRRHVMMHPKFGVERLINISEQVLEEALEIEAAAVENVEVLEGINNSLRLLNRGRLLVLHFVEEALQLVSLHDAVLGVSGEQVLDVGGSLGGGEAEAAAEAEANTVSLLR RHYSERGTETWR | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,541.438 | ||
| Theoretical pI: | 5.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 55.758 | ||
| aromaticity | 0.038 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.205 | ||
| sheet | 0.402 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331919.1 | internal | 237 | 3-713(+) |
Amino Acid sequence : | |||
| PPRFCSPFRIMSSKQTYRVCFCFRRRFRLAASEAPADVKDLFATYSENGVMEAHQLQRFLHEVQDQKAATVEEAQAIIDSFKHLNIFHRRGFNLEGFFKYLFADVNEPLDAKLGVHHDMT APLSHYYIYTGHNSYLTGNQLSSDCSDVPIINALHRGVRVIELDIWPNSTGDNVNVLHGRTLTTPVELIKCLKSIKENAFVASEYPVVITLEDHLTPDLQAKVAEMINQTFGDMILA | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 14,541.438 | ||
| Theoretical pI: | 5.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 55.758 | ||
| aromaticity | 0.038 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.205 | ||
| sheet | 0.402 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331919.1 | 3prime_partial | 132 | 398-3(-) |
Amino Acid sequence : | |||
| MASVYIIMGKRRRHVMMHPKFGVERLINISEQVLEEALEIEAAAVENVEVLEGINNSLRLLNRGRLLVLHFVEEALQLVSLHDAVLGVSGEQVLDVGGSLGGGEAEAAAEAEANTVSLLR RHYSERGTETWR | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,541.438 | ||
| Theoretical pI: | 5.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 55.758 | ||
| aromaticity | 0.038 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.205 | ||
| sheet | 0.402 | ||