Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331932.1 | internal | 169 | 2-508(+) |
Amino Acid sequence : | |||
IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYLRDWDYKRFR | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 12,126.735 | ||
Theoretical pI: | 4.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.131 | ||
aromaticity | 0.008 | ||
GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.305 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331932.1 | 5prime_partial | 150 | 3-455(+) |
Amino Acid sequence : | |||
SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 12,126.735 | ||
Theoretical pI: | 4.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.131 | ||
aromaticity | 0.008 | ||
GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.305 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331932.1 | 5prime_partial | 118 | 508-152(-) |
Amino Acid sequence : | |||
PKSLVIPVPQISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,126.735 | ||
Theoretical pI: | 4.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.131 | ||
aromaticity | 0.008 | ||
GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.305 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331932.1 | internal | 169 | 2-508(+) |
Amino Acid sequence : | |||
IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYLRDWDYKRFR | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 12,126.735 | ||
Theoretical pI: | 4.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.131 | ||
aromaticity | 0.008 | ||
GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.305 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331932.1 | 5prime_partial | 150 | 3-455(+) |
Amino Acid sequence : | |||
SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 12,126.735 | ||
Theoretical pI: | 4.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.131 | ||
aromaticity | 0.008 | ||
GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.305 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331932.1 | 5prime_partial | 118 | 508-152(-) |
Amino Acid sequence : | |||
PKSLVIPVPQISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,126.735 | ||
Theoretical pI: | 4.851 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 35.131 | ||
aromaticity | 0.008 | ||
GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.305 | ||
sheet | 0.254 |