| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331932.1 | internal | 169 | 2-508(+) |
Amino Acid sequence : | |||
| IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYLRDWDYKRFR | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 12,126.735 | ||
| Theoretical pI: | 4.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 35.131 | ||
| aromaticity | 0.008 | ||
| GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.305 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331932.1 | 5prime_partial | 150 | 3-455(+) |
Amino Acid sequence : | |||
| SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 12,126.735 | ||
| Theoretical pI: | 4.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 35.131 | ||
| aromaticity | 0.008 | ||
| GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.305 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331932.1 | 5prime_partial | 118 | 508-152(-) |
Amino Acid sequence : | |||
| PKSLVIPVPQISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,126.735 | ||
| Theoretical pI: | 4.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 35.131 | ||
| aromaticity | 0.008 | ||
| GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.305 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331932.1 | internal | 169 | 2-508(+) |
Amino Acid sequence : | |||
| IELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIY FESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYLRDWDYKRFR | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 12,126.735 | ||
| Theoretical pI: | 4.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 35.131 | ||
| aromaticity | 0.008 | ||
| GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.305 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331932.1 | 5prime_partial | 150 | 3-455(+) |
Amino Acid sequence : | |||
| SSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTPTTGSWASICLPAAISRTVTTLPAGRRSVPPRST SRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 12,126.735 | ||
| Theoretical pI: | 4.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 35.131 | ||
| aromaticity | 0.008 | ||
| GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.305 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331932.1 | 5prime_partial | 118 | 508-152(-) |
Amino Acid sequence : | |||
| PKSLVIPVPQISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAAVRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,126.735 | ||
| Theoretical pI: | 4.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 35.131 | ||
| aromaticity | 0.008 | ||
| GRAVY | 0.176 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.305 | ||
| sheet | 0.254 | ||