| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331941.1 | internal | 250 | 1-750(+) |
Amino Acid sequence : | |||
| IALNMEDGTLHRFRASSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREG RGVGPMKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDAVIPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAE VQRPGEEQKP | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 12,088.434 | ||
| Theoretical pI: | 5.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 49.173 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.443 | ||
| turn | 0.189 | ||
| sheet | 0.368 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331941.1 | complete | 119 | 408-49(-) |
Amino Acid sequence : | |||
| MIQVKVDMIFHGSNTTAFSDFHSHRSRYNISRGKILGSWGISFHKPFTFTVPKNTTFTSGTFSDETPSTIYACGMKLNKLKVLERQSCTCNHSIAISGASVSRSSRKVCSTISPCSKNC* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,088.434 | ||
| Theoretical pI: | 5.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 49.173 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.443 | ||
| turn | 0.189 | ||
| sheet | 0.368 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331941.1 | complete | 106 | 20-340(+) |
Amino Acid sequence : | |||
| MEPYTGSVLPQQFLLQGDMVEHTFLLLLLTLAPEMAMLWLHVQDCLSRTLSLFNFIPQAYMVLGVSSLKVPEVKVVFLGTVKVKGLWNDMPQLPRILPLEMLYLDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,088.434 | ||
| Theoretical pI: | 5.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 49.173 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.443 | ||
| turn | 0.189 | ||
| sheet | 0.368 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331941.1 | internal | 250 | 1-750(+) |
Amino Acid sequence : | |||
| IALNMEDGTLHRFRASSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREG RGVGPMKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDAVIPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAE VQRPGEEQKP | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 12,088.434 | ||
| Theoretical pI: | 5.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 49.173 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.443 | ||
| turn | 0.189 | ||
| sheet | 0.368 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331941.1 | complete | 119 | 408-49(-) |
Amino Acid sequence : | |||
| MIQVKVDMIFHGSNTTAFSDFHSHRSRYNISRGKILGSWGISFHKPFTFTVPKNTTFTSGTFSDETPSTIYACGMKLNKLKVLERQSCTCNHSIAISGASVSRSSRKVCSTISPCSKNC* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,088.434 | ||
| Theoretical pI: | 5.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 49.173 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.443 | ||
| turn | 0.189 | ||
| sheet | 0.368 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY331941.1 | complete | 106 | 20-340(+) |
Amino Acid sequence : | |||
| MEPYTGSVLPQQFLLQGDMVEHTFLLLLLTLAPEMAMLWLHVQDCLSRTLSLFNFIPQAYMVLGVSSLKVPEVKVVFLGTVKVKGLWNDMPQLPRILPLEMLYLDL* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,088.434 | ||
| Theoretical pI: | 5.108 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 49.173 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
| Helix | 0.443 | ||
| turn | 0.189 | ||
| sheet | 0.368 | ||