Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331941.1 | internal | 250 | 1-750(+) |
Amino Acid sequence : | |||
IALNMEDGTLHRFRASSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREG RGVGPMKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDAVIPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAE VQRPGEEQKP | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 12,088.434 | ||
Theoretical pI: | 5.108 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 49.173 | ||
aromaticity | 0.094 | ||
GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
Helix | 0.443 | ||
turn | 0.189 | ||
sheet | 0.368 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331941.1 | complete | 119 | 408-49(-) |
Amino Acid sequence : | |||
MIQVKVDMIFHGSNTTAFSDFHSHRSRYNISRGKILGSWGISFHKPFTFTVPKNTTFTSGTFSDETPSTIYACGMKLNKLKVLERQSCTCNHSIAISGASVSRSSRKVCSTISPCSKNC* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 12,088.434 | ||
Theoretical pI: | 5.108 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 49.173 | ||
aromaticity | 0.094 | ||
GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
Helix | 0.443 | ||
turn | 0.189 | ||
sheet | 0.368 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331941.1 | complete | 106 | 20-340(+) |
Amino Acid sequence : | |||
MEPYTGSVLPQQFLLQGDMVEHTFLLLLLTLAPEMAMLWLHVQDCLSRTLSLFNFIPQAYMVLGVSSLKVPEVKVVFLGTVKVKGLWNDMPQLPRILPLEMLYLDL* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,088.434 | ||
Theoretical pI: | 5.108 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 49.173 | ||
aromaticity | 0.094 | ||
GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
Helix | 0.443 | ||
turn | 0.189 | ||
sheet | 0.368 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331941.1 | internal | 250 | 1-750(+) |
Amino Acid sequence : | |||
IALNMEDGTLHRFRASSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREG RGVGPMKDHIYLHLNHLPPEVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGDDPDAVIPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAE VQRPGEEQKP | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 12,088.434 | ||
Theoretical pI: | 5.108 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 49.173 | ||
aromaticity | 0.094 | ||
GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
Helix | 0.443 | ||
turn | 0.189 | ||
sheet | 0.368 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331941.1 | complete | 119 | 408-49(-) |
Amino Acid sequence : | |||
MIQVKVDMIFHGSNTTAFSDFHSHRSRYNISRGKILGSWGISFHKPFTFTVPKNTTFTSGTFSDETPSTIYACGMKLNKLKVLERQSCTCNHSIAISGASVSRSSRKVCSTISPCSKNC* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 12,088.434 | ||
Theoretical pI: | 5.108 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 49.173 | ||
aromaticity | 0.094 | ||
GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
Helix | 0.443 | ||
turn | 0.189 | ||
sheet | 0.368 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331941.1 | complete | 106 | 20-340(+) |
Amino Acid sequence : | |||
MEPYTGSVLPQQFLLQGDMVEHTFLLLLLTLAPEMAMLWLHVQDCLSRTLSLFNFIPQAYMVLGVSSLKVPEVKVVFLGTVKVKGLWNDMPQLPRILPLEMLYLDL* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,088.434 | ||
Theoretical pI: | 5.108 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 49.173 | ||
aromaticity | 0.094 | ||
GRAVY | 0.595 | ||
Secondary Structure Fraction | |||
Helix | 0.443 | ||
turn | 0.189 | ||
sheet | 0.368 |