Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY331945.1 | 5prime_partial | 149 | 3-452(+) |
Amino Acid sequence : | |||
IQRKLLGCLSIRVCSAFCNSLCFSSLAPMAGPYRSREGLITRSAAYGGNSEEFQVRIEPDFEDEVTGLRKQVRRLRDVAQEIETEAKFQNDFLNQLQMTLIKAQAGVKNNMRRLNKSIVW EGSNHVMHVVLFALLIFFVVHLLAKVSRR* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 16,986.581 | ||
Theoretical pI: | 9.633 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 52.990 | ||
aromaticity | 0.081 | ||
GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.201 | ||
sheet | 0.282 |